PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G077500.1
Common NamePHAVU_011G077500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YC
Protein Properties Length: 171aa    MW: 19141.9 Da    PI: 10.4665
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G077500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC43.28.4e-14631491399
               NF-YC  13 atdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                          +d+k + +P+ ri+ ++k +    ++s ea   + ka e f+ ++t  s+  + + +++ l    +a++v++ + +dfl d vp++
  Phvul.011G077500.1  63 GEDVKTNVFPMNRIRTLIKGEGPDMRVSQEAVLTINKAVEKFLEQFTQDSYACCVQDRKKCLSYKHVANVVSKKMRYDFLSDFVPEK 149
                         579****************9988889**********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.54E-1749142IPR009072Histone-fold
PfamPF008081.9E-1371133IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.7E-2271148IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASSNTPKSP KAKKGEISTT QCKTKKKNRD IAKEENQKKK NKRPKLSNGN SKQPQEKGAE  60
GSGEDVKTNV FPMNRIRTLI KGEGPDMRVS QEAVLTINKA VEKFLEQFTQ DSYACCVQDR  120
KKCLSYKHVA NVVSKKMRYD FLSDFVPEKV KAEDALRERN AAGNGVFQKI *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150393e-97AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132235.11e-123hypothetical protein PHAVU_011G077500g
TrEMBLV7AFD11e-123V7AFD1_PHAVU; Uncharacterized protein
STRINGGLYMA11G20740.13e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.11e-29nuclear factor Y, subunit C10